PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK06515.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 90aa    MW: 10438.5 Da    PI: 10.2815
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK06515.5genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-133478147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +W +eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
        PK06515.5 34 RESWAEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 78
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.95E-172884IPR009057Homeodomain-like
PROSITE profilePS5129415.4392983IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.9E-83187IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-183281IPR006447Myb domain, plants
SMARTSM007174.3E-103381IPR001005SANT/Myb domain
PfamPF002493.4E-113478IPR001005SANT/Myb domain
CDDcd001671.98E-73679No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
XKMNSNPSNN PQSTTPADAS AKKIRKPYTI TKSRESWAEE EHDKFLEALQ LFDRDWKKIE  60
DFVGSKTVIQ IRSHAQKYFQ KVQKNGTLAH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010100834.11e-51Transcription factor ASG4
SwissprotQ8RWU34e-47RVE8_ARATH; Protein REVEILLE 8
TrEMBLW9RLU71e-51W9RLU7_9R
STRINGBra029778.1-P7e-46(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29563372
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.25e-45MYB_related family protein